DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and Uqcrb

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001121025.1 Gene:Uqcrb / 362897 RGDID:1311971 Length:111 Species:Rattus norvegicus


Alignment Length:106 Identity:65/106 - (61%)
Similarity:79/106 - (74%) Gaps:6/106 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PAV------LSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRLPRKLYDERNYRIMRALHL 68
            |||      |....:|.||.:|||:.||.|||.::|.||||||:||||..||::|.:||.|||.|
  Rat     5 PAVAASSKWLDGFRKWYYNAAGFNKLGLMRDDTMHETEDVKEAIRRLPENLYNDRMFRIKRALDL 69

  Fly    69 SMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREEREDWEK 109
            ||...||||:||||||||..|||||||||::||:|||:|.|
  Rat    70 SMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 51/87 (59%)
UqcrbNP_001121025.1 UCR_14kD 10..106 CDD:280439 58/95 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354020
Domainoid 1 1.000 130 1.000 Domainoid score I5074
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4460
OMA 1 1.010 - - QHG48987
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm45030
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3089
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.