DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and qcr7

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_588364.1 Gene:qcr7 / 2539439 PomBaseID:SPCC737.02c Length:137 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:53/118 - (44%)
Similarity:75/118 - (63%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNYIARKGPAV------LSNLGRWAY-NLSGFNQYGLHRDD-CLYENEDVKEAVRRLPRKLYDE 57
            ::.|| :|.|.:      :||    || :|||:.:|||..|| .|.||:|.::|:.|||:....:
pombe     6 LAKYI-QKSPFLTKLLLPISN----AYVHLSGYRKYGLRYDDLMLEENDDTQKALSRLPKMESYD 65

  Fly    58 RNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKEREEREDWEKI 110
            |.|||.||:.||:...||||.:|||.|||..||.|.|.||:.||:|||.::.:
pombe    66 RVYRIRRAMQLSIENKILPKSEWTKPEEDYHYLRPVLAEVIAERKEREAFDAL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 41/89 (46%)
qcr7NP_588364.1 UCR_14kD 16..113 CDD:280439 47/100 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2123
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1758
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm47163
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 1 1.000 - - X3089
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.