DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UQCR-14 and T02H6.11

DIOPT Version :9

Sequence 1:NP_573110.1 Gene:UQCR-14 / 32586 FlyBaseID:FBgn0030733 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_493795.1 Gene:T02H6.11 / 173459 WormBaseID:WBGene00020181 Length:130 Species:Caenorhabditis elegans


Alignment Length:100 Identity:36/100 - (36%)
Similarity:62/100 - (62%) Gaps:5/100 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLSNLGRWAY-NLSGFNQYGLHRDDCLYE-NEDVKEAVRRLPRK---LYDERNYRIMRALHLSMT 71
            :.|.|.::|: ||.|..:|||...|..:| ..:|.||:|||..:   ::|:|..|:.||..|::.
 Worm    18 IASTLRKFAWSNLWGGREYGLQFHDTYFEPAPEVTEALRRLNLQEPHVFDQRKIRLSRAHTLALH 82

  Fly    72 KTILPKEQWTKYEEDVKYLEPYLKEVVKEREERED 106
            ...|||.:||:::::..||:|||.|:..|::.|.:
 Worm    83 GEKLPKAEWTQWDQESWYLKPYLDEIEAEKKARAE 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UQCR-14NP_573110.1 UCR_14kD 12..94 CDD:396723 31/86 (36%)
T02H6.11NP_493795.1 UCR_14kD 19..116 CDD:280439 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167463
Domainoid 1 1.000 61 1.000 Domainoid score I6920
eggNOG 1 0.900 - - E1_KOG3440
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I3958
Isobase 1 0.950 - 0 Normalized mean entropy S1136
OMA 1 1.010 - - QHG48987
OrthoDB 1 1.010 - - D1606436at2759
OrthoFinder 1 1.000 - - FOG0003729
OrthoInspector 1 1.000 - - otm14778
orthoMCL 1 0.900 - - OOG6_103572
Panther 1 1.100 - - LDO PTHR12022
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1049
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.