DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and EKI1

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_010431.3 Gene:EKI1 / 851725 SGDID:S000002554 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:77/308 - (25%)
Similarity:128/308 - (41%) Gaps:73/308 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWP 268
            :|:||:|:..|.:|||:.|.:....|..|.|.|.|...|:||...:|:.|:..:|.:........
Yeast   159 LLMRIFGDSIDSVIDREYELKVIARLSFYDLGPKLEGFFENGRFEKYIEGSRTSTQADFIDRDTS 223

  Fly   269 L-VARRMAEMHRKVRKHGDSSATKPM--------PMIWKKTQSFLDLVPERFSDAEKHKRVKET- 323
            : :|:::.|:|          .|.|:        |..|.....::.|:.........:..:.|. 
Yeast   224 IKIAKKLKELH----------CTVPLTHKEITDQPSCWTTFDQWIKLIDSHKEWVSNNVNISENL 278

  Fly   324 -------FLPIGRLREEFNKLYEYL-------------EALDSPI------VFSHNDLLLGNVIY 362
                   ||      :.|.....:|             :..||.|      ||.||||..||:::
Yeast   279 RCSSWNFFL------KSFKNYKRWLYNDSAFTSKLLREDDKDSMINSGLKMVFCHNDLQHGNLLF 337

  Fly   363 TQ------SLNTVNFIDYEYADYNFQAFDIGNHFAE-MCGVDEVD-----YSRYPKREFQLQWLR 415
            ..      |:..:..||:|||..|...||:.||..| |...::|.     ..:|||.|..|    
Yeast   338 KSKGKDDISVGDLTIIDFEYAGPNPVVFDLSNHLNEWMQDYNDVQSFKSHIDKYPKEEDIL---- 398

  Fly   416 VYLEEYLQRSN-----IQNDEVELLYVQVNQFALASHIFWTVWSLLQA 458
            |:.:.|:...|     |.:.||.:||..:.::...:.:||.:|:|||:
Yeast   399 VFAQSYINHMNENHVKIASQEVRILYNLIIEWRPCTQLFWCLWALLQS 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 77/308 (25%)
EKI1NP_010431.3 Choline_kin_N 79..129 CDD:367938
ETNK_euk 135..508 CDD:270706 77/308 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - otm46544
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.