DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and CKI1

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_013234.1 Gene:CKI1 / 850824 SGDID:S000004123 Length:582 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:80/336 - (23%)
Similarity:134/336 - (39%) Gaps:101/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGT-TLNTDSVLCPEIW 267
            :|:||||...|.:|||:.|.|....|....:.||||..|.||...:::..: ||..|.:...:..
Yeast   172 LLLRIYGPNIDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNS 236

  Fly   268 PLVARRMAEMHRKV------RKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLP 326
            ..:||||.|:|..|      ||:|.:        .|:|...:|..:.:........|.::.:.  
Yeast   237 QRIARRMKELHVGVPLLSSERKNGSA--------CWQKINQWLRTIEKVDQWVGDPKNIENSL-- 291

  Fly   327 IGRLREEFNKLYEY--------------LEALDSPIVFSHNDLLLGNVIYTQS-LNTVNF----- 371
               |.|.::|..:.              :|.::..::|.|||...||:::|.. :||.:.     
Yeast   292 ---LCENWSKFMDIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPS 353

  Fly   372 ---------------------------------------IDYEYADYNFQAFDIGNHFAE----- 392
                                                   ||:|||..|..|:|:.||.:|     
Yeast   354 STSLTSQSSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDY 418

  Fly   393 -------MCGVDEVDYSRYPKREFQLQWLRVYLEEYLQRSNIQ---NDEVELLYVQVNQFALASH 447
                   .|..|     |||.:|..|.:|..|:...  |...:   ::||:.||..:.|:.....
Yeast   419 NNAKAPHQCHAD-----RYPDKEQVLNFLYSYVSHL--RGGAKEPIDEEVQRLYKSIIQWRPTVQ 476

  Fly   448 IFWTVWSLLQA 458
            :||::|::||:
Yeast   477 LFWSLWAILQS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 80/336 (24%)
CKI1NP_013234.1 Choline_kin_N 94..144 CDD:367938
ETNK_euk 148..556 CDD:270706 80/336 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3046
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - otm46544
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.