DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and AT1G74320

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_177572.2 Gene:AT1G74320 / 843772 AraportID:AT1G74320 Length:350 Species:Arabidopsis thaliana


Alignment Length:301 Identity:94/301 - (31%)
Similarity:147/301 - (48%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWP 268
            |||||||...::..||:.|.:.|..:..:|..|.|...|.||.:.|::...||:...:..|||..
plant    70 VLVRIYGEGVEIFFDREDEIRTFEFMSKHGHGPLLLGRFGNGRIEEFLHARTLSACDLRDPEISG 134

  Fly   269 LVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREE 333
            .:|.||.|.| .:...|...|     ::|.:.:::|... :|.:..|:.|..:     :..:..|
plant   135 RIATRMKEFH-GLEMPGAKKA-----LLWDRLRNWLTAC-KRLASPEEAKSFR-----LDVMEME 187

  Fly   334 FNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCG--- 395
            .|.|.:.|...|..|.|.||||..||::..:....:..|||||:.||..|:||.|||.||..   
plant   188 INMLEKSLFDNDENIGFCHNDLQYGNIMMDEETKAITIIDYEYSCYNPVAYDIANHFCEMAADYH 252

  Fly   396 ---VDEVDYSRYPKREFQLQWLRVYLEEYLQRSNIQNDE------VELLYVQVNQFALASHIFWT 451
               ...:|||:||..|.:.::|:.|:.        .:||      |:.|...|.::.||||:.|.
plant   253 TETPHIMDYSKYPGVEERQRFLKTYMS--------YSDEKPSDTMVKKLLEDVEKYTLASHLIWG 309

  Fly   452 VWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLSLTAAK 492
            :|.::....:.|||||:.||..|:.:|...|...|:.:..|
plant   310 LWGIISEHVNEIDFDYMEYARQRFEQYWLTKPRLLAASEHK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 90/285 (32%)
AT1G74320NP_177572.2 PLN02236 3..346 CDD:177880 93/295 (32%)
ETNK_euk 41..337 CDD:270706 90/286 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - otm2988
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.