DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and CK1

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_177315.1 Gene:CK1 / 843500 AraportID:AT1G71697 Length:346 Species:Arabidopsis thaliana


Alignment Length:289 Identity:93/289 - (32%)
Similarity:138/289 - (47%) Gaps:28/289 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWP 268
            |||||||:..||..:|..|.:.|..:..:|..|.|...|.:|.:.|::...||:.|.:...|...
plant    70 VLVRIYGDGVDLFFNRGDEIKTFECMSHHGYGPKLLGRFSDGRLEEFIHARTLSADDLRVAETSD 134

  Fly   269 LVARRMAEMHRKVRKHGDSSATKPMP---MIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRL 330
            .:|.::.|.|:         ...|.|   ::|::.:::|.......|..|..|...|      .|
plant   135 FIAAKLREFHK---------LDMPGPKNVLLWERLRTWLKEAKNLASPIEMDKYRLE------GL 184

  Fly   331 REEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCG 395
            ..|.|.|.|.|...|..|.|.||||..|||:..:..|.:..|||||:.:|..|:||.|||.||..
plant   185 ENEINLLEERLTRDDQEIGFCHNDLQYGNVMIDEVTNAITIIDYEYSSFNPIAYDIANHFCEMAA 249

  Fly   396 ------VDEVDYSRYPKREFQLQWLRVYLEEYLQRSNIQND-EVELLYVQVNQFALASHIFWTVW 453
                  ...:||:.||....:.:::..||.   ...|..:| |||.|......:.||:||||.:|
plant   250 NYHSDTPHVLDYTLYPGEGERRRFISTYLG---STGNATSDKEVERLLKDAESYTLANHIFWGLW 311

  Fly   454 SLLQAEHSTIDFDYVGYAFLRYNEYLARK 482
            .::....:.|:|||:.||..|:.:|..||
plant   312 GIISGHVNKIEFDYMEYARQRFEQYWLRK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 90/283 (32%)
CK1NP_177315.1 PLN02236 1..344 CDD:177880 93/289 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - otm2988
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.