DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and AT4G09760

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_192714.1 Gene:AT4G09760 / 826564 AraportID:AT4G09760 Length:346 Species:Arabidopsis thaliana


Alignment Length:292 Identity:88/292 - (30%)
Similarity:146/292 - (50%) Gaps:25/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWP 268
            :|||:||...:|..:|..|.:.|..:..:|..|:|...|..|.|.|::...||:...:..|.|..
plant    68 LLVRVYGEGVELFFNRDDEIRTFEYVARHGHGPTLLGRFAGGRVEEFIHARTLSATDLRDPNISA 132

  Fly   269 LVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPIGRLREE 333
            |||.::...| .:...||.     :.:||.:.::::.......|:  :|    .|...:..:.:|
plant   133 LVASKLRRFH-SIHIPGDR-----IMLIWDRMRTWVGQAKNLCSN--EH----STEFGLDDIEDE 185

  Fly   334 FNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCG--- 395
            .|.|.:.:.. :..|.|.||||..||::..:..|.:..||||||.||..|:||.|||.||..   
plant   186 INLLEQEVNN-EQEIGFCHNDLQYGNIMIDEETNAITIIDYEYASYNPIAYDIANHFCEMAADYH 249

  Fly   396 ---VDEVDYSRYPKREFQLQWLRVYLEEYLQRS--NIQNDEVELLYVQVNQFALASHIFWTVWSL 455
               ...:||:.||..|.:    |.::..||..|  ..:.:::|.|...:.::.||||:||.:|.:
plant   250 SNTPHILDYTLYPGEEER----RRFICNYLTSSGEEAREEDIEQLLDDIEKYTLASHLFWGLWGI 310

  Fly   456 LQAEHSTIDFDYVGYAFLRYNEYLARKVEFLS 487
            :....:.|:|||:.|:..|:.:|..||.:.||
plant   311 ISGYVNKIEFDYIEYSRQRFKQYWLRKPKLLS 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 83/281 (30%)
AT4G09760NP_192714.1 PLN02236 1..343 CDD:177880 88/292 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - otm2988
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.