DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and chka

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001011466.1 Gene:chka / 496957 XenbaseID:XB-GENE-5775623 Length:441 Species:Xenopus tropicalis


Alignment Length:513 Identity:133/513 - (25%)
Similarity:197/513 - (38%) Gaps:181/513 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ISTSGGNPKVMKDSLSLVRQTVNQQTLSLSQSNQVQNQLNSHSNSNSYPNPSGSENKNENEQNSR 78
            |||:||                    |..:|...|:            |...|...|.|:     
 Frog    19 ISTAGG--------------------LMTAQRGAVE------------PEVLGVTEKQED----- 46

  Fly    79 DIRAKPEDKSRKEA---IVPFVPIFVEEADVIQGAKELLKVIRPTWDLSHVEFKSFTDGITNKLV 140
                .|..|:|::|   ...|:|          ||..:|:..|     .|:..  ...|::|.|.
 Frog    47 ----APNPKTRRKAYRWCKEFLP----------GAWRVLEEER-----FHISV--IRGGLSNMLY 90

  Fly   141 GCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVL 205
            .|               .||                   ||:...:::..:            ||
 Frog    91 LC---------------SLP-------------------EDEKSLSNEPRS------------VL 109

  Fly   206 VRIYG-------NKTDLLIDRKAETQNFL--------------LLHTYGLAPSLYATFKNGLVYE 249
            :|:||       ||.:   :::.:.|||.              :|....|.|.||..|..|.:.|
 Frog   110 LRLYGAILQMSCNKGE---NQETQRQNFFQGAEAMVMESVMFAILAERSLGPKLYGIFPQGRLEE 171

  Fly   250 YVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSD- 313
            ::|...|.|..:..|::...:|.:||      |.||       |.|.:.|...:|....|::.. 
 Frog   172 FIPSRKLETSELSLPDLSAEIAEKMA------RFHG-------MNMPFNKEPKWLFGTMEKYLQQ 223

  Fly   314 -------AEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIY-----TQSL 366
                   .|.|.|.....|... |.:|...|...|||..||:||.|||...||::.     ....
 Frog   224 VLKIKFTRESHTRKLNKILAYD-LSKEMRSLRCLLEATSSPVVFCHNDCQEGNILLLDGRENSEK 287

  Fly   367 NTVNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDY------------SRYPKREFQLQWLRVYLE 419
            ..:..||:||:.||::.|||||||.|..    .||            |:||.|..|:.::..||.
 Frog   288 QKLMLIDFEYSSYNYRGFDIGNHFCEWM----YDYTFEKFPFFKATFSKYPTRRQQIHFVNSYLT 348

  Fly   420 EYLQR-SNIQNDEV-----ELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYA 471
            |:|.. .||.|:|.     ||| :::|:||||||.||.:||::||:.|:|:|.|:..|
 Frog   349 EFLPGFENISNEEQSKLENELL-IEINRFALASHFFWGLWSIVQAKISSIEFGYMPMA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 110/398 (28%)
chkaNP_001011466.1 PLN02236 38..405 CDD:177880 123/460 (27%)
ChoK_euk 76..415 CDD:270705 111/400 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.