DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and CG2201

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001033932.2 Gene:CG2201 / 35417 FlyBaseID:FBgn0032955 Length:554 Species:Drosophila melanogaster


Alignment Length:383 Identity:86/383 - (22%)
Similarity:142/383 - (37%) Gaps:121/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYG--NKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEI 266
            ||:||||  :....|.....|:..|.||......|.|:..|..|.:.:|:|...|.|..:....|
  Fly   189 VLLRIYGQTHGDHALESMITESVVFALLSERNYGPKLHGIFPGGRIEQYIPARALTTAELGEQRI 253

  Fly   267 WPLVARRMAEMHRKVRKHGDSSATKPM----PMIWKKTQSFLDLVPERFSDAEKHKRVKETFLPI 327
            ...||.:|.|:|         |...||    ..||...|.::..: |...:.......|.:.|  
  Fly   254 LKRVAEKMGEIH---------SLNIPMSKEPDWIWNCMQRWVSGL-ESIVNGSVQTNQKSSVL-- 306

  Fly   328 GRLREEFNKLYEYLEAL----------DSPIVFSHNDLLLGNVIYTQ------------------ 364
             :.:.|..:.::|::.:          |.|:||.||||..||::..|                  
  Fly   307 -KKQMELMRTFDYVQEMAWIRSIIDEGDYPVVFCHNDLQEGNILMRQPSAGQNERTPRESISSLR 370

  Fly   365 ----------------------------------SLNTVN-----------------FIDYEYAD 378
                                              .|:|.|                 .||:||..
  Fly   371 SNFDETLGDSLDGNSNISDTETHKSRSVSPSPCPELDTTNDSALDSSFMADNEPDLIIIDFEYCA 435

  Fly   379 YNFQAFDIGNHFAEMCGVDEVDYS--RYP--------------KREFQLQWLRVYLEEYLQRSNI 427
            ||::.:|:.|||.|.    ..||:  ::|              :|:|.:.:|:.:.::  :..||
  Fly   436 YNYRGYDLANHFIEW----TFDYTNPQFPYFYHNSSNCATVQQRRDFIVNYLKKFHDD--ENYNI 494

  Fly   428 QNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEF 485
            ...|:..:..::..|.:.||:||::||::... |.|:|.|..|...|..||...|..:
  Fly   495 TGQELMKVDAEIQFFTMLSHLFWSLWSVINVT-SAIEFGYWEYGIARILEYQKLKAAY 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 83/374 (22%)
CG2201NP_001033932.2 ChoK_euk 159..549 CDD:270705 85/379 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471428
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3046
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113251at6656
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22603
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.