DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and SPAC13G7.12c

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_593714.1 Gene:SPAC13G7.12c / 2542839 PomBaseID:SPAC13G7.12c Length:456 Species:Schizosaccharomyces pombe


Alignment Length:361 Identity:93/361 - (25%)
Similarity:147/361 - (40%) Gaps:88/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDS 260
            |..|....:|:||||...:|.|:|:.|.:|...|..:.:.|.|...|.||...:|:..|||...:
pombe    82 PEGYHAPKLLLRIYGPHVELFINRQVELENLKRLARHNIGPYLIGEFSNGRFEQYMESTTLTCKT 146

  Fly   261 VLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKHKRVKETFL 325
            :..|::...|.||:.|:|..:..|  ......||..||....:|.....:....:....:...|:
pombe   147 IRDPKLSIYVGRRLCELHNFILLH--PHEVLEMPAAWKNCLVWLPKAKAKILGRKHSLAITSEFM 209

  Fly   326 PIGRLREEFNKLYEYL--------EALDSPIVFSHNDLLLGNVI----------YTQSLNTVNFI 372
            .  .|.|:||..|.:.        :.....:||||||...||::          .:|...|:..:
pombe   210 K--TLEEDFNAYYNWFVEWSRDKKDWFGLKMVFSHNDTQYGNLLKIKAKKRSIPLSQKHRTLVPV 272

  Fly   373 DYEYADYNFQAFDIGNHFAE-MCGVDE------VDYSRYPKREFQLQWLRVYLEEYLQRSNIQND 430
            |:|||..|..|||:.|:||| |.....      :|.||||  :|..:.| || ..|:::|.:.||
pombe   273 DFEYAGPNLCAFDLANYFAEWMADYHHPTHNYLMDRSRYP--DFNARKL-VY-HAYVEQSAVIND 333

  Fly   431 EVEL------------------------LYVQVNQFALASHIFWTVWSLLQ-------------- 457
            .:|:                        |...|...:.|::|.|.:|.:||              
pombe   334 LLEIEDASLLKTDISDELKNTFEKQIMNLEESVRAISPAANIGWALWGILQCLEEDDEWEDLSVS 398

  Fly   458 -----------AEHSTI------DFDYVGYAFLRYN 476
                       .|.||:      .|||:||:..:::
pombe   399 SQVADRPEKQLVEGSTVPPIGTSSFDYIGYSSEKFD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 93/361 (26%)
SPAC13G7.12cNP_593714.1 Choline_kin_N 11..61 CDD:282307
ETNK_euk 63..438 CDD:270706 93/361 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 1 1.000 - - oto100560
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22603
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.