DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and ckb-1

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_497879.2 Gene:ckb-1 / 181904 WormBaseID:WBGene00000511 Length:371 Species:Caenorhabditis elegans


Alignment Length:280 Identity:68/280 - (24%)
Similarity:116/280 - (41%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 ETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHG- 285
            :|.||.:....||.|.||..|..|.:.|::|..||::|.:|.|||    :||:..::.|.  |. 
 Worm    82 DTVNFAIFSERGLGPKLYGFFDGGRMEEFLPSRTLDSDCILDPEI----SRRVGAVYPKY--HAI 140

  Fly   286 DSSATKP---MPMIWKKTQSFLDL-------VPERFSDAEKHKRVK--ETFLPIGRLREEFNKLY 338
            |...:|.   ..::.:..:.:.||       .|...:.:|..|::.  :.:..|..:.:..|:|:
 Worm   141 DVPVSKKRRCFQVMRESLKEYQDLGGGDYEIKPTTVTYSEHPKKISMDDLYKEIDFMEKWTNELF 205

  Fly   339 EYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFIDYEYADYNFQAFDIGNHFAEMCG-------- 395
            |      ..:||.||||...|::...|...:..||:|:..||.:.||:..|.||...        
 Worm   206 E------DTVVFCHNDLASSNILELNSTKELVLIDWEFGSYNCRGFDLAMHLAETAADFRDSTPP 264

  Fly   396 ---VDEVDYSRYPKREFQLQWLRVYLEEYLQRSN-IQNDEVELLYVQVNQFALASHIFWTVWSLL 456
               :.|......|.       |:.:.|.|:...| ::|.......::|:........||.:..|.
 Worm   265 GIRISEELTDNPPN-------LQGFCEAYVDADNKLKNRVPSNRDLEVSNLICECQFFWPITQLF 322

  Fly   457 QAEHSTIDFDYVGYAFLRYN 476
            .|      ...:..|.|:||
 Worm   323 WA------CFVMKLALLKYN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 68/280 (24%)
ckb-1NP_497879.2 PLN02236 30..356 CDD:177880 68/280 (24%)
PKc_like 42..357 CDD:304357 68/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3046
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.