DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and Chka

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_006531709.1 Gene:Chka / 12660 MGIID:107760 Length:463 Species:Mus musculus


Alignment Length:473 Identity:115/473 - (24%)
Similarity:183/473 - (38%) Gaps:165/473 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KPEDKSRKEAIV---PFVPIFVEEADVIQGAKELLKVIRPTWDLSHVEFKSFTDGITNKLVGC-F 143
            :||.::|:.|.:   .|:|      ...:|.:|         |..|:..  ...|::|.|..| .
Mouse    78 QPEPRTRRRAYLWCKEFLP------GAWRGLRE---------DQFHISV--IRGGLSNMLFQCSL 125

  Fly   144 HKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPVQYSDNVVLVRI 208
            ...|:.:.||      |.|                                         ||:|:
Mouse   126 PDSIASVGDE------PRK-----------------------------------------VLLRL 143

  Fly   209 YGN--KTDLLI-------------DRKAETQN--------------FLLLHTYGLAPSLYATFKN 244
            ||.  |...||             ..:|:.:|              |.:|....|.|.|:..|..
Mouse   144 YGAILKMVFLIKLWNGKRSCNKEGSEQAQNENEFQGAEAMVLESVMFAILAERSLGPKLFGIFPQ 208

  Fly   245 GLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPE 309
            |.:.:::|...|:|:.:..|:|...:|.:||..|             .|.|.:.|...:|....|
Mouse   209 GRLEQFIPSRRLDTEELRLPDISAEIAEKMATFH-------------GMKMPFNKEPKWLFGTME 260

  Fly   310 RFSDA------EKHKRVKETF------LPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIY 362
            ::.:.      .:..||::..      ||:     |...|...|:...||:||.|||...||::.
Mouse   261 KYLNQVLRLKFSREARVQQLHKILSYNLPL-----ELENLRSLLQYTRSPVVFCHNDCQEGNILL 320

  Fly   363 TQSLNT-----VNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYS------------RYPKREFQ 410
            .:....     :..||:||:.||::.|||||||.|..    .||:            :||.|:.|
Mouse   321 LEGQENSERRKLMLIDFEYSSYNYRGFDIGNHFCEWM----YDYTYEKYPFFRANIQKYPSRKQQ 381

  Fly   411 LQWLRVYLEEYLQRSNIQNDEVEL-----------LYVQVNQFALASHIFWTVWSLLQAEHSTID 464
            |.::..||      :..|||...|           :.::||:||||||..|.:||::||:.|:|:
Mouse   382 LHFISSYL------TTFQNDFESLSSEEQFATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIE 440

  Fly   465 FDYVGYAFLRYNEYLARK 482
            |.|:.||..|:..|..:|
Mouse   441 FGYMEYAQARFEAYFDQK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 103/421 (24%)
ChkaXP_006531709.1 ChoK_euk 107..458 CDD:270705 105/427 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.