DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and Chkb

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_031718.1 Gene:Chkb / 12651 MGIID:1328313 Length:394 Species:Mus musculus


Alignment Length:317 Identity:105/317 - (33%)
Similarity:160/317 - (50%) Gaps:60/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 VLVRIYG---NKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPE 265
            ||:|:||   ...|.|:   .|:..|.:|....|.|.||..|..|.:.:|:|...|.|..:..|.
Mouse   101 VLLRLYGAILQGVDSLV---LESVMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPV 162

  Fly   266 IWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVPERFSDAEKH-KRVKE---TFLP 326
            :...:|.|||      |.||       |.|.:.|...:|      |...|:: |::::   |.||
Mouse   163 LSGAIATRMA------RFHG-------MEMPFTKEPRWL------FGTMERYLKQIQDLPSTSLP 208

  Fly   327 ------IGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIY---TQSLNTVNFIDYEYADYNFQ 382
                  :..|::|.|.|.:.|:...||:||.|||:..||::.   ..|.:.:..:|:||:.||::
Mouse   209 QMNLVEMYSLKDEMNSLRKLLDDTPSPVVFCHNDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYR 273

  Fly   383 AFDIGNHFAEMCGVDEVDY------------SRYPKREFQLQWLRVYLEEYLQRSNIQNDE---- 431
            .|||||||.|..    .||            :.||.||.||.::|.||.| :|:..|.::|    
Mouse   274 GFDIGNHFCEWV----YDYTYEEWPFYKARPTDYPTREQQLHFIRHYLAE-VQKGEILSEEEQKK 333

  Fly   432 -VELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARKVEFLS 487
             .|.|.:::::::||||.||.:||.|||..|||:|.|:.||..|:..|..:|.:..|
Mouse   334 REEELLLEISRYSLASHFFWGLWSTLQASMSTIEFGYLEYAQSRFQFYFQQKGQLTS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 102/306 (33%)
ChkbNP_031718.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
PLN02236 57..391 CDD:177880 105/317 (33%)
ChoK_euk 73..385 CDD:270705 103/310 (33%)
Substrate binding. /evidence=ECO:0000250 77..79
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.