DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and CHKA

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001363148.1 Gene:CHKA / 1119 HGNCID:1937 Length:467 Species:Homo sapiens


Alignment Length:487 Identity:115/487 - (23%)
Similarity:191/487 - (39%) Gaps:165/487 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 PNPSGSENKNENEQNSRDIRAKPEDKSRKEAIV---PFVPIFVEEADVIQGAKELLKVIRPTWDL 123
            |.|...|              :||.::|:.|.:   .|:|      ...:|.:|         |.
Human    75 PQPPADE--------------QPEPRTRRRAYLWCKEFLP------GAWRGLRE---------DE 110

  Fly   124 SHVEFKSFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDD 188
            .|:..  ...|::|.|..|               .||..|..|    .::|              
Human   111 FHISV--IRGGLSNMLFQC---------------SLPDTTATL----GDEP-------------- 140

  Fly   189 RAADDGSPVQYSDNVVLVRIYGNKTDLLI---------------DRKAETQN------------- 225
                         ..||:|:||....::.               ..:|:.:|             
Human   141 -------------RKVLLRLYGAILQMVFLIKLWNGKRSCNKEGSEQAQKENEFQGAEAMVLESV 192

  Fly   226 -FLLLHTYGLAPSLYATFKNGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSA 289
             |.:|....|.|.||..|..|.:.:::|...|:|:.:..|:|...:|.:||..|           
Human   193 MFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFH----------- 246

  Fly   290 TKPMPMIWKKTQSFL---------DLVPERFSDAEKHKRVKETF---LPIGRLREEFNKLYEYLE 342
              .|.|.:.|...:|         :::..:|::..:.|::.:..   ||:     |...|...||
Human   247 --GMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPL-----ELENLRSLLE 304

  Fly   343 ALDSPIVFSHNDLLLGNVIYTQSLNT-----VNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYS 402
            :..||:||.|||...||::..:....     :..||:||:.||::.|||||||.|..    .|||
Human   305 STPSPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWM----YDYS 365

  Fly   403 ------------RYPKREFQLQWLRVYLEEYLQR-SNIQNDE----VELLYVQVNQFALASHIFW 450
                        :||.::.||.::..||..:... .|:..:|    .|.:.::||:||||||..|
Human   366 YEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW 430

  Fly   451 TVWSLLQAEHSTIDFDYVGYAFLRYNEYLARK 482
            .:||::||:.|:|:|.|:.||..|::.|..:|
Human   431 GLWSIVQAKISSIEFGYMDYAQARFDAYFHQK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 100/414 (24%)
CHKANP_001363148.1 ChoK_euk 111..462 CDD:270705 102/420 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3046
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.