DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eas and chkb

DIOPT Version :9

Sequence 1:NP_523364.2 Gene:eas / 32585 FlyBaseID:FBgn0000536 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001120148.1 Gene:chkb / 100145186 XenbaseID:XB-GENE-5953721 Length:436 Species:Xenopus tropicalis


Alignment Length:401 Identity:115/401 - (28%)
Similarity:172/401 - (42%) Gaps:104/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 IRPTW-DLSHVEFK--SFTDGITNKLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIE 178
            :|..| ::...:|:  ..:.|::|.|..|      .|.|.       :|||...|.|        
 Frog   101 LRGVWREIQPHQFRVSVVSGGLSNLLYKC------SLTDS-------VKTQSTEPRQ-------- 144

  Fly   179 KEDDDEFTDDRAADDGSPVQYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFK 243
                                     ||:|:||.....:.....|:..|.:|....|.|.||..|.
 Frog   145 -------------------------VLLRLYGAILQGVNSLVQESVMFAILAERSLGPRLYGVFP 184

  Fly   244 NGLVYEYVPGTTLNTDSVLCPEIWPLVARRMAEMHRKVRKHGDSSATKPMPMIWKKTQSFLDLVP 308
            .|.:.||:|...|.|..:.||::...:|.::|..|:             |.|.:.|...:|....
 Frog   185 QGRLEEYIPSRRLLTSELSCPDVSSEIAEKLARFHK-------------MEMPFNKKPVWLFRTM 236

  Fly   309 ERF------------SDAEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVI 361
            |.:            .|.||..::|..     .|.||..||...|.:..||:||.|||:..||::
 Frog   237 EEYMSQISSLSFTQKEDVEKFNQLKSL-----SLEEEMQKLKLLLLSTASPVVFCHNDVQEGNIL 296

  Fly   362 YTQSLNT-----VNFIDYEYADYNFQAFDIGNHFAEMCGVDEVDYSR------------YPKREF 409
            ...|.::     :..||:||:.||::.|||||||.|..    .:|..            ||.|..
 Frog   297 LLSSRSSSPSDRLMLIDFEYSSYNYRGFDIGNHFCEWA----YNYQHNEWPFYKAQLNDYPSRVQ 357

  Fly   410 QLQWLRVYLEEY---LQRSNIQNDEVELLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYA 471
            ||::.|.||.|.   |.... ::.:.|.:.::||:||||||.||.:||:|||:.|||:|.|:.||
 Frog   358 QLRFFRSYLLEMSPGLSEGE-RHAQEEAMLLEVNRFALASHFFWGLWSILQAKMSTIEFGYLDYA 421

  Fly   472 FLRYNEYLARK 482
            ..|:|.|..:|
 Frog   422 LSRFNAYFEQK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
easNP_523364.2 ETNK_euk 126..478 CDD:270706 111/385 (29%)
chkbNP_001120148.1 PLN02236 101..434 CDD:177880 115/401 (29%)
ChoK_euk 113..432 CDD:270705 112/387 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000493
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.