DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_446042.1 Gene:Psmb1 / 94198 RGDID:621092 Length:240 Species:Rattus norvegicus


Alignment Length:258 Identity:52/258 - (20%)
Similarity:100/258 - (38%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRAVTIFSPDGHL--LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQE-----DRKVRK 63
            ||.: :..|.|..  :|:.::..|. .|.|.:.:.|.:..::.    |..:|.|     .|...|
  Rat    11 DREL-VMGPQGSAGPVQMRFSPYAF-NGGTVLAIAGEDFSIVA----SDTRLSEGFSIHTRDSPK 69

  Fly    64 ICMLDNHVVMAFAGLTADARIM--INRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGR 126
            ...|.:..|:..:|...|...:  |..|:::...|..|      ....|..||.:......|...
  Rat    70 CYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN------KAMTTGAIAAMLSTILYSRRF 128

  Fly   127 RPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVAN-EHGAV 190
            .|:.:..:|.|.|.:|...::..:|.|.:......|.|.::.:::...:.....:.:.| ||..:
  Rat   129 FPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPL 193

  Fly   191 KL--AIRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVIT-DYVK--IIEKE--KEEELEKKK 246
            .|  |:|.:.:|.                 :...:.||.| |.::  |:.||  :||.:..:|
  Rat   194 TLDRAMRLVKDVF-----------------ISAAERDVYTGDALRICIVTKEGIREETVPLRK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 46/237 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 42/218 (19%)
Psmb1NP_446042.1 proteasome_beta_type_1 29..240 CDD:239726 47/239 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.