DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PRE1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:51/208 - (24%)
Similarity:89/208 - (42%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGVRGANCVVLGVEK---KSVAQLQE-DRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQS 95
            :|:|..:.|:|...|   :.::.|:: |.|.|:   |..|.:|:|||...|........|...|.
Yeast     5 LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQ---LSPHTLMSFAGEAGDTVQFAEYIQANIQL 66

  Fly    96 HRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFD-ADGSAHLFQTEPSGIFYEYK 159
            :.:..:..::.:.::.|:.|...|..:|  |||:.::.||||:| ......|:|.:..|...|..
Yeast    67 YSIREDYELSPQAVSSFVRQELAKSIRS--RRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELP 129

  Fly   160 ANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSGQNNLEVAIMENGKPLKMLDT 224
            ..|.|.|........:..||.:....|                 |.:.|::.:.|..|.:.|...
Yeast   130 YGAHGYSGFYTFSLLDHHYRPDMTTEE-----------------GLDLLKLCVQELEKRMPMDFK 177

  Fly   225 DVITDYVKIIEKE 237
            .||   |||::|:
Yeast   178 GVI---VKIVDKD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 47/200 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 42/182 (23%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 51/208 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.