DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PRE2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:37/224 - (16%)
Similarity:86/224 - (38%) Gaps:26/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VRKGSTAVGVRGANCVVLGVEKKSVA-QLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQV 91
            :..|:|.:..|....:::.|:.::.| .....:.|:|:..::..::...||..||.:........
Yeast    72 IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGS 136

  Fly    92 ECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFY 156
            :|:.|.|..::.:::...::.::.|..:|..:.    ..:..:|.|:.......::..:..|...
Yeast   137 QCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTIYYVDSDGTRL 197

  Fly   157 EYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVA-----QSGQNNL----EVAI 212
            :......|..........:.:|:.:  .:...|:.|..|::|..|     ..|..||    |...
Yeast   198 KGDIFCVGSGQTFAYGVLDSNYKWD--LSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGW 260

  Fly   213 MENGKPLKMLDTDVITDYVKIIEKEKEEE 241
            :.:|.          .|..::..|.||||
Yeast   261 IYHGN----------HDVGELFWKVKEEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 32/212 (15%)
proteasome_alpha_type_7 5..213 CDD:239724 30/194 (15%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 29/193 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.