DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PRE5

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:72/234 - (30%)
Similarity:115/234 - (49%) Gaps:8/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            :.||.....|||.|.|.|||||.||:::||..||:|.....||...|::..:|...:|  ||...
Yeast     4 NNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQK--KIIKC 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            |.|:.::.|||..|||::.|..:.:|....|.....:.:|.....:....||.|||.|.||:|:.
Yeast    67 DEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSYGGRPYGVG 131

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYRE--EEVANEHGAVKLAIR 195
            .||.|:|..| |||.:.:|||...|....|.|..::..:.:.|::...  :...|....:|..:.
Yeast   132 LLIIGYDKSG-AHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKAGVE 195

  Fly   196 ALLEVAQSGQ---NNLEVAIMENGKPLKMLDTDVITDYV 231
            |:.:..:...   :||.:||:....|..:.|.:.:..|:
Yeast   196 AISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 71/230 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 68/212 (32%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 69/213 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.