DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PRE10

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_015007.1 Gene:PRE10 / 854544 SGDID:S000005889 Length:288 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:80/242 - (33%)
Similarity:128/242 - (52%) Gaps:12/242 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69
            ||.:.::|||||...|||||.:||..|:|::|::..:.||..|||...::|...:|..||.::|.
Yeast     8 YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKIQVVDR 72

  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134
            |:...::||..|.|.::||.:.|..|.:...:.|:.:......:.|..|.:|..|..||||:|.:
Yeast    73 HIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYNSVRPFGVSTI 137

  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGR---SAKVVREFFEKSYREEEVANEHGAVKLAIRA 196
            .||.|.:| |||:..||||.::.||..|||:   |||...|.....:.|...|.|  |||.|.:.
Yeast   138 FGGVDKNG-AHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGLSARE--AVKQAAKI 199

  Fly   197 LLEVAQSGQN---NLEV---AIMENGKPLKMLDTDVITDYVKIIEKE 237
            :....:..:.   .||:   ::.|.....|.:..|::.:.:...:||
Yeast   200 IYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 78/234 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 75/216 (35%)
PRE10NP_015007.1 proteasome_alpha_type_3 5..219 CDD:239720 75/213 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.