DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PUP1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:59/236 - (25%)
Similarity:99/236 - (41%) Gaps:38/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EAVRKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRA 89
            :|...|:|.|||:..|.||:..:.:|. ..:..|:...|:..:...:..|.||..||...:....
Yeast    24 KATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLI 88

  Fly    90 QVECQSHRL-NVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSG 153
            ....:.|.| ...:|    .:...:..|||...:..|.  .|...::.|.|..|| |||.....|
Yeast    89 GSNIELHSLYTSREP----RVVSALQMLKQHLFKYQGH--IGAYLIVAGVDPTGS-HLFSIHAHG 146

  Fly   154 ---IFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSG-------QNNL 208
               :.|.....:...:|..|.|    |:.::::..|. |:|||..|:    |:|       .:|:
Yeast   147 STDVGYYLSLGSGSLAAMAVLE----SHWKQDLTKEE-AIKLASDAI----QAGIWNDLGSGSNV 202

  Fly   209 EVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :|.:||.||     |.:.:.:|:....:|     ||:|..|
Yeast   203 DVCVMEIGK-----DAEYLRNYLTPNVRE-----EKQKSYK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 53/216 (25%)
proteasome_alpha_type_7 5..213 CDD:239724 48/198 (24%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 51/209 (24%)
Pr_beta_C 223..257 CDD:403609 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.