DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PAE1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001077717.1 Gene:PAE1 / 841822 AraportID:AT1G53850 Length:237 Species:Arabidopsis thaliana


Alignment Length:218 Identity:83/218 - (38%)
Similarity:128/218 - (58%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            :.|||.|..|||:|.|.|||||.||::.||||:||:....|||.|||:..:.|.|...|.||..:
plant     6 TEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEI 70

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKY---TQSNGRRPF 129
            |:|:..|.:||.||||.::..|:||.|:||.:..:|:|:|..|:.:..|..::   .:.:..|||
plant    71 DDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEEESMSRPF 135

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAK----VVREFFEKSYREEEVANEHGAV 190
            |:|.||.|.|.:|.: |:.|:|||.|::..|.|.|..::    .::|.|.|....:|      |.
plant   136 GVSLLIAGHDENGPS-LYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQFNKDLSLQE------AE 193

  Fly   191 KLAIRALLEVAQS--GQNNLEVA 211
            .:|:..|.:|.:.  ..||:::|
plant   194 TIAVSILKQVMEEKVTPNNVDIA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 83/216 (38%)
proteasome_alpha_type_7 5..213 CDD:239724 83/216 (38%)
PAE1NP_001077717.1 proteasome_alpha_type_5 8..218 CDD:239722 83/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.