DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PAB1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001031057.1 Gene:PAB1 / 838217 AraportID:AT1G16470 Length:235 Species:Arabidopsis thaliana


Alignment Length:235 Identity:74/235 - (31%)
Similarity:137/235 - (58%) Gaps:5/235 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            |:|..::|.|||.|.|:|:|:|..||..|.|::|::.:|.||:..|||..:.|.::..|:||..|
plant     4 SQYSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHL 68

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            ..::.:.::|:..|.|:::.:::.:.:.:....::|:.:..:.|..|.:.|::|||.|.||||:|
plant    69 TPNIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVS 133

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRAL 197
            .|:.|:| |....|:|.:|||.::.:||:|.|::....:.|.||.|.|:...::  |:..||..|
plant   134 LLVAGYD-DKGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDD--AIHTAILTL 195

  Fly   198 LE--VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIE 235
            .|  ..:....|:|:..:...|..::|....|.||:..:|
plant   196 KEGFEGEISSKNIEIGKIGADKVFRVLTPAEIDDYLAEVE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 71/227 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 67/209 (32%)
PAB1NP_001031057.1 proteasome_alpha_type_2 6..232 CDD:239719 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.