DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PAF1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_199093.1 Gene:PAF1 / 834290 AraportID:AT5G42790 Length:278 Species:Arabidopsis thaliana


Alignment Length:242 Identity:86/242 - (35%)
Similarity:136/242 - (56%) Gaps:6/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            ::||..||.:||.|.|.|||||.|||::||.|:|:|..:.|||....|:.::|...:  |||..:
plant     4 NQYDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQ--RKIFKV 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS 132
            |:|:.:|.||||||.|::....:.|..:|....|.|:.:..:...:|...|..||.:.:||:|:.
plant    67 DDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVG 131

  Fly   133 CLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRAL 197
            .|:||.|..| |||:...|||.::||:|.|.|..::..:.:.|:.:.....::....:|.||.|:
plant   132 LLVGGLDESG-AHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERRFESFGDSSREDLIKDAILAV 195

  Fly   198 LEVAQSG--QNNL-EVAIMENGKPLKMLDTDVITDYVKIIEKEKEEE 241
            .|..|..  :::| .|||:...:|...||.:.|...:...||..|||
plant   196 RETLQGETLKSSLCTVAILGVDEPFHFLDQEAIQKVIDTFEKVPEEE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 81/228 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 76/210 (36%)
PAF1NP_199093.1 proteasome_alpha_type_1 6..215 CDD:239718 77/211 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.