DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PBB1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_566818.1 Gene:PBB1 / 822364 AraportID:AT3G27430 Length:273 Species:Arabidopsis thaliana


Alignment Length:202 Identity:42/202 - (20%)
Similarity:77/202 - (38%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVRKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADARIMIN 87
            |...::.|:|.||:...:.|:||.:.::. ..:..|:...||..:..::....||..||...:.:
plant    32 APSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTD 96

  Fly    88 RAQVECQSHRLNV-EDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEP 151
            ....:.:.||... .|...:..:|    .||:......|.  ...:.::||.|..| .||....|
plant    97 MVSSQLRLHRYQTGRDSRVITALT----LLKKHLFSYQGH--VSAALVLGGVDITG-PHLHTIYP 154

  Fly   152 SGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSG-------QNNLE 209
            .|..........|..:......||..|:|....:|      .|:.:.|...||       .:|::
plant   155 HGSTDTLPFATMGSGSLAAMSVFEAKYKEGLTRDE------GIKLVAESICSGIFNDLGSGSNVD 213

  Fly   210 VAIMENG 216
            :.::..|
plant   214 ICVITKG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 42/202 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 41/197 (21%)
PBB1NP_566818.1 proteasome_beta_type_7 40..228 CDD:239732 40/194 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.