DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and AT3G26340

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_189265.1 Gene:AT3G26340 / 822238 AraportID:AT3G26340 Length:273 Species:Arabidopsis thaliana


Alignment Length:185 Identity:34/185 - (18%)
Similarity:73/185 - (39%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AQEAVR--KGSTAVGVRGANCVVLGVEKK-SVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIM 85
            |.|.|:  ||:|.:.......|::..:.: |:......:.|:||..::.:::...||..||.:..
plant    48 AVEMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFW 112

  Fly    86 INRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGIS--CLIGGFD--------- 139
            .....::|:.|.|..:..:::...::.:|.:...|      |..|:|  .:|.|:|         
plant   113 HRNLGIKCRLHELANKRRISVSGASKLLANMLYSY------RGMGLSVGTMIAGWDETGPGLYYV 171

  Fly   140 --------------ADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYRE 180
                          ..||.:.:....||  |::..:....|....|..:..::|:
plant   172 DNEGGRLKGDRFSVGSGSPYAYGVLDSG--YKFDMSVEEASELARRSIYHATFRD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 34/185 (18%)
proteasome_alpha_type_7 5..213 CDD:239724 34/185 (18%)
AT3G26340NP_189265.1 proteasome_beta_type_5 58..245 CDD:239730 29/175 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.