DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psmb11

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_780413.1 Gene:Psmb11 / 73902 MGIID:1921152 Length:302 Species:Mus musculus


Alignment Length:78 Identity:18/78 - (23%)
Similarity:24/78 - (30%) Gaps:32/78 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 GSAHLFQTEPSG----------IFYE-------------------YKANATGRSAKVVREFFEKS 177
            ||..||....||          :.|.                   |...||.:.|:..:|.|   
Mouse   221 GSVDLFHVRESGWEYVSRSDACVLYRELQKARSLEQELEAKACGIYPEPATPQGARECKELF--- 282

  Fly   178 YREEEVANEHGAV 190
            ..:|||..|..|:
Mouse   283 VEQEEVTPEDCAI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 18/78 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 18/78 (23%)
Psmb11NP_780413.1 20S_bact_beta 48..253 CDD:163402 7/31 (23%)
proteasome_beta_type_5 50..237 CDD:239730 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.