DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psmb7

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021324576.1 Gene:psmb7 / 64278 ZFINID:ZDB-GENE-001208-4 Length:286 Species:Danio rerio


Alignment Length:239 Identity:54/239 - (22%)
Similarity:99/239 - (41%) Gaps:28/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DGHLLQVEYAQEAVRK-GSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAG 77
            :..:.::.::..|.|| |:|..|:...:.||||.:.::. ..:..|:...||..:..::....||
Zfish    26 EADITKLGFSSPAARKTGTTICGIVYKDGVVLGADTRATEGMIVADKNCSKIHYISPNIYCCGAG 90

  Fly    78 LTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADG 142
            ..||..:.........:.|.|:......:....|.:.|:..:|     :...|.:.::||.|..|
Zfish    91 TAADTEMTTQIISSNLELHSLSTGRLPRVATANRMLKQMLFRY-----QGYIGAALVLGGVDCTG 150

  Fly   143 SAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYR---EEEVANEHGAVKLAIRALLEVAQSG 204
             .||:...|.|...:......|..:......||..||   |||.|.  ..|:.||.|.:......
Zfish   151 -PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDRYRPDMEEEDAK--SLVRDAIAAGIFNDLGS 212

  Fly   205 QNNLEVAIMENGKPLKMLDTDVITDYVK---IIEKE--KEEELE 243
            .:|::|.::..||          .||::   |..|:  :|::|:
Zfish   213 GSNIDVCVITKGK----------VDYLRPHDIANKKGVREDKLD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 49/220 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 46/202 (23%)
psmb7XP_021324576.1 proteasome_beta_type_7 44..232 CDD:239732 46/205 (22%)
Pr_beta_C 237..280 CDD:315191 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.