DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMB10

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:248 Identity:58/248 - (23%)
Similarity:101/248 - (40%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSV-AQLQEDRKVRKICMLDNHVVMAFAGLTADA 82
            |:|.:|:   :.|:|..|:...:.|:||.:.::. ..:..|:...||..:...:....||:.|||
Human    30 LKVPHAR---KTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADA 91

  Fly    83 RIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLF 147
            .:.......:.:.|.|:......:..:||.:.|...:|     :...|.|.::||.|..| ..|:
Human    92 EMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRY-----QGHVGASLIVGGVDLTG-PQLY 150

  Fly   148 QTEPSGIF--YEYKANATGRSA--KVVREFFEKSYREEEVANEHGAVKLAIRA-LLEVAQSGQNN 207
            ...|.|.:  ..:.|..:|:.|  .|:.:.|:.:...|..   .|.:..|:.| :|....||.|.
Human   151 GVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAA---QGLLVEAVTAGILGDLGSGGNV 212

  Fly   208 LEVAIMENG-KPLKMLD------------------TDVITDYVKIIEKEKEEE 241
            ....|.:.| |.|:.|.                  |.|:|..||.:..|..||
Human   213 DACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 53/236 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 45/199 (23%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 45/195 (23%)
Pr_beta_C 232..267 CDD:403609 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.