DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMB3

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002786.2 Gene:PSMB3 / 5691 HGNCID:9540 Length:205 Species:Homo sapiens


Alignment Length:200 Identity:46/200 - (23%)
Similarity:68/200 - (34%) Gaps:69/200 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKKSVAQLQ-EDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94
            |...:.::|.|||.:..:::...|.| .....:||..:.:.:.:..|||..|.:.:..|.:    
Human     8 GGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLK---- 68

  Fly    95 SHRLNVED--------PVTLE-------YITRF--------IAQLKQKYTQSNGRRPFGISC-LI 135
             .|||:.:        |.||.       |..||        ||.|..|..     :||..|. ||
Human    69 -FRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTF-----KPFICSLDLI 127

  Fly   136 G------GFDADGSA-------------------HLFQTEPSGIFYEYKANATGRSA----KVVR 171
            |      .|...|:.                   |||:|....:.     ||..|.|    .|:.
Human   128 GCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAML-----NAVDRDAVSGMGVIV 187

  Fly   172 EFFEK 176
            ...||
Human   188 HIIEK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 45/199 (23%)
proteasome_alpha_type_7 5..213 CDD:239724 45/199 (23%)
PSMB3NP_002786.2 proteasome_beta_type_3 6..201 CDD:239728 45/199 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.