DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMB1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens


Alignment Length:264 Identity:53/264 - (20%)
Similarity:100/264 - (37%) Gaps:52/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVTIFSPDGHLLQVEYAQEA----------VRKGSTAVGVRGANCVVLGVEKKSVAQLQE----- 57
            :..::|..|..|.:|..:.|          |..|.|.:.:.|.:..::.    |..:|.|     
Human     4 STAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVA----SDTRLSEGFSIH 64

  Fly    58 DRKVRKICMLDNHVVMAFAGLTADARIM--INRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKY 120
            .|...|...|.:..|:..:|...|...:  |..|:::...|..|      ....|..||.:....
Human    65 TRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNN------KAMTTGAIAAMLSTI 123

  Fly   121 TQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVAN 185
            ..|....|:.:..:|||.|.:|...::..:|.|.:......|.|.::.:::...:.....:.:.|
Human   124 LYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQN 188

  Fly   186 -EHGAVKL--AIRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVIT-DYVK--IIEKE--KEEEL 242
             ||..:.|  |:|.:.:|.                 :...:.||.| |.::  |:.||  :||.:
Human   189 VEHVPLSLDRAMRLVKDVF-----------------ISAAERDVYTGDALRICIVTKEGIREETV 236

  Fly   243 EKKK 246
            ..:|
Human   237 SLRK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 47/243 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 43/224 (19%)
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 48/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.