DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMA4

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:259 Identity:84/259 - (32%)
Similarity:147/259 - (56%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKV-RKI 64
            ||.|||...|||||:|.|.|||||.||:....|.:|:...:.|:|..|::::.:|.::... .||
Human     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..|:..:..:.||:|:||.::.|..::..|.:.|..::|:..|.:...:..:||.|||..|:|||
Human    66 YKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
            |:|.|..|:|......|:|::|||.:..:||...|.::.......::.|:|.|:..: .|:.|||
Human   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLK-SALALAI 194

  Fly   195 RAL---LEVAQSGQNNLEVAIM--ENGKP----LKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :.|   ::|::.....:|:|.:  ||||.    ||..:.:      ::|:|.:|||.:.:::||
Human   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVE------QLIKKHEEEEAKAEREKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 74/235 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 68/211 (32%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 69/213 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.