DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and PSMA3

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002779.1 Gene:PSMA3 / 5684 HGNCID:9532 Length:255 Species:Homo sapiens


Alignment Length:253 Identity:83/253 - (32%)
Similarity:129/253 - (50%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69
            ||.:.:.|||||.:.|||||.:||...|||:|:|..:.||.||||..:::|.|:...:::..:|.
Human     8 YDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDR 72

  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134
            ||.||.|||.||||.:.:.|:.|..:.|.|....:.|:::...:|.....||..:..||||.|.:
Human    73 HVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFM 137

  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREE--------EVAN----EH 187
            :|.:..:..|.|:..:|||:.|.|...|.|::.:..:...||...:|        |||.    .|
Human   138 LGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVH 202

  Fly   188 GAVKLAIRAL-LEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEK 244
            ..||  .:|. ||::..|:       :.||:.             :|:.|:..||.||
Human   203 DEVK--DKAFELELSWVGE-------LTNGRH-------------EIVPKDIREEAEK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 77/238 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 75/220 (34%)
PSMA3NP_002779.1 proteasome_alpha_type_3 5..217 CDD:239720 74/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.