DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652031.2 Gene:Prosbeta1 / 46058 FlyBaseID:FBgn0010590 Length:224 Species:Drosophila melanogaster


Alignment Length:180 Identity:34/180 - (18%)
Similarity:64/180 - (35%) Gaps:13/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EYAQEAVRKGSTAVGVRGANCVVLGVEKK-SVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIM 85
            ::....|..|:|.:.|.....||:|.:.: |......:|...|:..:.:.|....:|..||.:.:
  Fly     6 DFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLTRITDKVYCCRSGSAADTQAI 70

  Fly    86 INRAQVECQSHRLNV-EDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQT 149
            .:........|.... :|.:..|..:.|     :.|..|. |.......::.|:|......::..
  Fly    71 ADIVAYSLNYHENQTNKDALVFEAASEF-----RNYCYSY-RESLLAGIIVAGWDEQRGGQVYSI 129

  Fly   150 EPSGIFYEYKANATGRSAKVVREFFEKSYR-----EEEVANEHGAVKLAI 194
            ...|:.........|..:..:..|..:.||     |:.|.....||:.||
  Fly   130 PLGGMLTRESCTIGGSGSSFIYGFVREHYRPNMALEDCVTFVKKAVQHAI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 34/180 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 34/180 (19%)
Prosbeta1NP_652031.2 20S_bact_beta 15..201 CDD:163402 33/171 (19%)
proteasome_beta_type_6 16..203 CDD:239731 32/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.