DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psmb1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:258 Identity:50/258 - (19%)
Similarity:94/258 - (36%) Gaps:51/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSPDGHLLQVEYAQEAVRK-------GSTAVGVRGANCVVLGVEKKSVAQLQE-----DRKVRKI 64
            :..:|.:.:..|......|       |.|.:.|.|.:..::.    |..:|.|     .|...|.
Zfish     7 YGENGKMKEYHYTGPVEHKFSPYAFNGGTVLAVAGEDFAIVA----SDTRLSEGYSIHSRDSPKC 67

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRR-- 127
            ..|.:..|:..:|...|...:....:...:.::.:....:|...|...::      |...|||  
Zfish    68 YKLTDTTVLGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLS------TILYGRRFF 126

  Fly   128 PFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVAN-EH---- 187
            |:.:..:|||.|.:|...::..:|.|.:......|.|.::.:::...:.....:.:.| ||    
Zfish   127 PYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVPLT 191

  Fly   188 --GAVKLAIRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKE--KEEELEKKK 246
              .||:|.....:..|:..        :..|..||          |.|:.||  |||.:..:|
Zfish   192 QEKAVQLVKDVFISAAERD--------VYTGDALK----------VCIVSKEGIKEEIVPLRK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 42/239 (18%)
proteasome_alpha_type_7 5..213 CDD:239724 39/221 (18%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 48/243 (20%)
proteasome_beta_type_1 26..237 CDD:239726 47/239 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.