DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psmb2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:210 Identity:45/210 - (21%)
Similarity:87/210 - (41%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGVRGANCVVL---GVEKKSVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSH 96
            :|::|.:.|::   .|...|:.|::.|  ..|:..|...:::...|...|........|...|.:
Zfish     5 IGIQGPDFVLVAADNVAASSIIQMKHD--YDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLY 67

  Fly    97 RLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFY-EY-- 158
            ::.....::......|..:....|.:|  |.|:.::.|:.|:|        :|:..|::| :|  
Zfish    68 KMRNGYELSPAAAANFTRKNLADYLRS--RTPYHVNLLLAGYD--------ETDGPGLYYMDYLS 122

  Fly   159 ---KA--NATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEVAQSGQNNLEVAIMENGKP 218
               ||  .|.|..|.:.....::.||.:....|  ||.|..:.|.|:.:....||.      ...
Zfish   123 ALAKAPFAAHGYGAFLTLSILDRYYRPDLTREE--AVDLLKKCLEELNKRFILNLP------SFT 179

  Fly   219 LKMLDTDVITDYVKI 233
            ::::|.|.|.|..|:
Zfish   180 VRLIDKDGIHDMEKL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 44/206 (21%)
proteasome_alpha_type_7 5..213 CDD:239724 40/188 (21%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 44/206 (21%)
PRE1 5..188 CDD:223711 42/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.