DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psmb10

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001002543.2 Gene:psmb10 / 436816 ZFINID:ZDB-GENE-040718-278 Length:276 Species:Danio rerio


Alignment Length:225 Identity:53/225 - (23%)
Similarity:96/225 - (42%) Gaps:19/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DGHLLQVEYAQEAVRK-GSTAVGVRGANCVVLGVEKKSVAQL-QEDRKVRKICMLDNHVVMAFAG 77
            :.:|.:..|:....|| |:|..|:...:.|:||.:.::...: ..|:...||..:..::....||
Zfish    25 EANLSEKGYSAPNARKTGTTIAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAG 89

  Fly    78 LTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADG 142
            :.|||.:.........:.|.|:...|..:..:||   ||||...:..|.  .|.|.::||.|.:|
Zfish    90 VAADAEVTTQMMSSNVELHSLSTGRPPLVAMVTR---QLKQMLFRYQGH--IGSSLIVGGVDVNG 149

  Fly   143 SAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREE-EVANEHGAVKLAIRALLEVAQSGQN 206
             |.|:...|.|.:.:......|..|......||..|:.. |:......|:.||.|.:.......:
Zfish   150 -AQLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAITAGIFCDLGSGS 213

  Fly   207 NLEVAIMENGKPLKMLDTDVITDYVKIIEK 236
            |:::.::          ||...||::..::
Zfish   214 NVDLCVI----------TDKKVDYLRTYDQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 52/218 (24%)
proteasome_alpha_type_7 5..213 CDD:239724 49/200 (25%)
psmb10NP_001002543.2 PRE1 40..224 CDD:223711 48/199 (24%)
proteasome_beta_type_7 43..231 CDD:239732 48/203 (24%)
Pr_beta_C 237..270 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.