DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:236 Identity:86/236 - (36%)
Similarity:141/236 - (59%) Gaps:8/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICM 66
            :.||..::|.|||.|.|:|:|||..||..|:.:||:..:|.||:..|.|..:.|.|...|.::.|
  Fly     3 TERYSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEM 67

  Fly    67 LDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGI 131
            :.||:.|.::|:..|.|:::.:|:...|::.|..::|:.:..:.:.:|.|.|:||||.|.||||:
  Fly    68 IYNHIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGV 132

  Fly   132 SCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRA 196
            |.||.|:|.| ..:|:|::|||.::.:||.|.|::|...:.|.||.|.|:...::  ||..||..
  Fly   133 SLLICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDD--AVHTAILT 194

  Fly   197 LLE--VAQSGQNNLEVAIM-ENGKPLKMLDTDVITDYVKII 234
            |.|  ..:...:|:|:.|. :||  .:.||...|.||:..|
  Fly   195 LKEGFEGKMTADNIEIGICDQNG--FQRLDPASIKDYLASI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 83/228 (36%)
proteasome_alpha_type_7 5..213 CDD:239724 76/209 (36%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.