DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta2R2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649515.3 Gene:Prosbeta2R2 / 40621 FlyBaseID:FBgn0037296 Length:322 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:92/218 - (42%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DRAVTIFSPDG----HLLQVEYAQE-------AVRKGSTAVGVRGANCVVLGVEKKSVA-QLQED 58
            ||:..:..|.|    :.|:.:..:|       :...|:|.||:.....|::|.|.::.: .:...
  Fly    13 DRSPFLCGPSGFTFDNCLRNKQLKENGLEEPNSFTTGTTVVGIVFDGGVIIGAESRATSGGIVFS 77

  Fly    59 RKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNV---EDPVTLEYITRFIAQLKQKY 120
            :..|||..|..::..|.||...|.:.::...:.:.:.||:|.   :.||..  ..:.|.||..::
  Fly    78 KTCRKIIELQANIFAAGAGTARDTKALVELTRAQLELHRMNTGFRKVPVCC--ANQMIRQLLFRF 140

  Fly   121 TQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVAN 185
               ||.  .....:|||.|..| ||||.|...|........:.|...:|.....|..:.|:  .:
  Fly   141 ---NGN--IDADMIIGGADNTG-AHLFCTRSDGSTDTAPFTSIGSGYQVSMSILESRWSED--LS 197

  Fly   186 EHGAVKLAIRALLEVAQSGQNNL 208
            |..|..||..|   ||...:|:|
  Fly   198 EESACALACDA---VAAGMKNDL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 55/218 (25%)
proteasome_alpha_type_7 5..213 CDD:239724 55/218 (25%)
Prosbeta2R2NP_649515.3 PRE1 9..228 CDD:223711 55/218 (25%)
proteasome_beta_type_7 50..239 CDD:239732 48/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441104
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.