DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:208 Identity:39/208 - (18%)
Similarity:81/208 - (38%) Gaps:22/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKK-SVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94
            |.:.|.:.|.:..|:..:.: |.......|...|:..|....|:..||..||...:....:|..|
  Fly    29 GGSIVAIAGDDFAVIAADTRLSSGYNIHSRTQSKLFKLSPQTVLGSAGCWADTLSLTGSIKVRMQ 93

  Fly    95 SHRLNVEDPVTLEYITRF--IAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYE 157
            |:.......:|.|.:.:.  ||...:::.      |:.:|.::.|.|.:|...::..:|.|...:
  Fly    94 SYEHTHLRTMTTEAVAQMLSIAMYNRRFF------PYYVSNILAGIDNEGKGVVYSYDPIGHCEK 152

  Fly   158 YKANATGRSAKVVREFFEKSYREEEVANEHG---------AVKLAIRALLEVAQ----SGQNNLE 209
            ....|.|.:..:::...:.....:.:..|..         ||.:|....:..|:    :|.:.|.
  Fly   153 ATYRAGGTAGTLLQPVLDNQIGHKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLI 217

  Fly   210 VAIMENGKPLKML 222
            ..|.::|..::.|
  Fly   218 NIITKDGIEVRTL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 39/208 (19%)
proteasome_alpha_type_7 5..213 CDD:239724 36/197 (18%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 39/208 (19%)
PRE1 24..225 CDD:223711 37/201 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.