DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and psma7

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_989071.1 Gene:psma7 / 394668 XenbaseID:XB-GENE-974596 Length:248 Species:Xenopus tropicalis


Alignment Length:245 Identity:171/245 - (69%)
Similarity:201/245 - (82%) Gaps:1/245 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICMLDN 69
            ||||:|:|||||||.|||||||||:||||||||||...|||||||||||:||::|.|||||.||.
 Frog     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKEIVVLGVEKKSVAKLQDERTVRKICALDE 67

  Fly    70 HVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCL 134
            :|.||||||||||||:||||:||||||||.||||||:|||||:||.|||:|||||||||||||.|
 Frog    68 NVFMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132

  Fly   135 IGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLE 199
            |.|||.||:..|:||:|||.::.:||||.||.||.||||.||.|.:|.:..:...:||.|:||||
 Frog   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDEAIETDDLTIKLVIKALLE 197

  Fly   200 VAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            |.|||..|:|:|:|...:|||:|:.:.|..||..|||||||. |||||||
 Frog   198 VVQSGGKNIELAVMRRDQPLKILNPEEIERYVAEIEKEKEEN-EKKKQKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 155/225 (69%)
proteasome_alpha_type_7 5..213 CDD:239724 149/207 (72%)
psma7NP_989071.1 proteasome_alpha_type_7 3..211 CDD:239724 149/207 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 259 1.000 Domainoid score I1952
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 341 1.000 Inparanoid score I2298
OMA 1 1.010 - - QHG62217
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - otm48186
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2243
SonicParanoid 1 1.000 - - X1345
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.