DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:251 Identity:151/251 - (60%)
Similarity:201/251 - (80%) Gaps:3/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKIC 65
            |:.||||||||:|||||||||||||||||:|||.:|:|..|.:|:||||:||..|||:|.|||||
  Fly     1 MAQRYDRAVTIYSPDGHLLQVEYAQEAVRRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKIC 65

  Fly    66 MLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFG 130
            |||:||||.|:||||||||:::|||:|.||||||.|.|.|:|||||:||||||.|||||||||||
  Fly    66 MLDDHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFG 130

  Fly   131 ISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREE--EVANEHGAVKLA 193
            :|||:||||.||:.|||||:|||||||::||.||||::.||::.|| :.:|  .:|:|..|:|..
  Fly   131 LSCLVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEK-HADEILTIADEAAAIKHI 194

  Fly   194 IRALLEVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :|.|:.|:......:|||:::..:||:|:|..|:.|..:.:.:|.|:|.|..::.:
  Fly   195 VRTLVSVSSLNHTQMEVAVLKYRQPLRMIDHQVLADLERTVRREIEDEAEASRRPR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 145/227 (64%)
proteasome_alpha_type_7 5..213 CDD:239724 139/209 (67%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 139/210 (66%)
Ntn_hydrolase 5..214 CDD:294319 139/209 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462327
Domainoid 1 1.000 220 1.000 Domainoid score I721
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 270 1.000 Inparanoid score I920
Isobase 1 0.950 - 0 Normalized mean entropy S208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002043
OrthoInspector 1 1.000 - - mtm1115
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1345
1110.850

Return to query results.
Submit another query.