DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:185 Identity:41/185 - (22%)
Similarity:80/185 - (43%) Gaps:24/185 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GSTAVGVRGANCVVLGVEKKSVA-QLQEDRKVRKICMLDNHVVMAFAGLTADA----RIMINRAQ 90
            |:|.:|.:....|:|..:.::.: |....:.:|||..|:::::...||..||.    |::..   
  Fly    71 GTTTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAK--- 132

  Fly    91 VECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGI--SCLIGGFDADGSAHLFQTEPSG 153
             ||:.|:|.....:|::...|.|..:..:|      :..|:  ..::.|||.:| ..|...:..|
  Fly   133 -ECRLHQLRYRKRMTVDTAARIICNISTEY------KGMGLVMGMMLAGFDDEG-PKLIYVDSEG 189

  Fly   154 IFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAIRALLEV----AQSG 204
            :....:..:.|..:.......:..||.:  .::..|..||.||:...    |.||
  Fly   190 MRSHGQVFSVGSGSPYALGVLDTGYRYD--LSDQEAYDLARRAIYHATSKDAYSG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 41/185 (22%)
proteasome_alpha_type_7 5..213 CDD:239724 41/185 (22%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 41/185 (22%)
proteasome_beta_type_5 72..259 CDD:239730 40/184 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.