DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:241 Identity:81/241 - (33%)
Similarity:129/241 - (53%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            |.|||.|..|||:|.|.|||||.||::.||||:|:.....|||.|||:..:.|.....|.||..:
  Fly     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMVPSTVEKIVEV 70

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNG------- 125
            |.|:..|.:||.||||.:|.||:||||:|.....:.:::|...:.::.|..::..|..       
  Fly    71 DKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAM 135

  Fly   126 RRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAV 190
            .||||::.|..|.:| |...|:..:|||.|..:.|.|.|..::..::..:..:|.:...:|  |:
  Fly   136 SRPFGVAILFAGIEA-GQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDE--AI 197

  Fly   191 KLAIRALLEVAQSGQN--NLEVAIMENGKPLKMLDTDVITDYVKII 234
            .:::..|.:|.:...|  |:||..|...:...|...:.:..::|.|
  Fly   198 DISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 78/234 (33%)
proteasome_alpha_type_7 5..213 CDD:239724 76/216 (35%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 79/237 (33%)
proteasome_alpha_type_5 8..222 CDD:239722 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.