DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:249 Identity:80/249 - (32%)
Similarity:137/249 - (55%) Gaps:17/249 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            ::||..||::||.|.|.|||||.|||:.|:..||::..:..||....|..::|.:.:  |||..:
  Fly     4 NQYDSDVTVWSPQGRLHQVEYAMEAVKLGTATVGLKNKDYAVLVALCKPTSELSDTQ--RKIIPI 66

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKY---TQSNGRRPF 129
            |:|:.::.||||||||::....:.||.:::.:.:   |...::|.|..|..|.   ||...|||:
  Fly    67 DDHLGISIAGLTADARVLSRYLRSECLNYKHSYD---TTYPVSRLITNLGNKMQTTTQRYDRRPY 128

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
            |:..|:.|:|..| .|::|..||..|:..|||:.|..::..|.:.||:..:...:::...::..|
  Fly   129 GVGLLVAGYDERG-PHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKDEIIRHGI 192

  Fly   195 RALL-------EVAQSGQNNLEVAIMENGKPLKMLDTDVITDYVKIIEKEKEEE 241
            ||:|       :...:||.::.|||:...:|..:|.......:| .|.||.:.:
  Fly   193 RAILGTLPTDEQGKDAGQYDITVAIVGKDQPFTILSNKDSAKHV-AIAKENDND 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 76/235 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 73/217 (34%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 76/232 (33%)
proteasome_alpha_type_1 6..219 CDD:239718 74/218 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.