DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:189 Identity:38/189 - (20%)
Similarity:77/189 - (40%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TAVGVRGANCVVLG---VEKKSVAQLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQ 94
            |.:||:|.:.::|.   :..||...|  |.:|||...:.::.:|:.||...|.....:.......
  Fly     3 TILGVKGTDFIILASDTMRNKSAMWL--DDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMD 65

  Fly    95 SHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYK 159
            .:::.....:|:.....||.:....|.:|:  ..|.:|.|:||:|......|...:..|.....:
  Fly    66 LYKITNGYDLTVRGAVHFIRRHLSAYLKSD--CTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVR 128

  Fly   160 ANATGRSAKVVREFFEKSYREE-EVANEHGAVKLAIRALLEVAQSGQNNLEV-AIMENG 216
            ....|.:........|:.|:.: :....:..:|..:..|.:.......|::: .|.:||
  Fly   129 YGGHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNG 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 38/189 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 35/184 (19%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 38/189 (20%)
proteasome_beta_type_2 1..193 CDD:239727 38/189 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.