DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Prosbeta5R2

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster


Alignment Length:212 Identity:44/212 - (20%)
Similarity:89/212 - (41%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSRYDRAVTIFSPDGHLLQVEYAQEAVRK-------------GSTAVGVRGANCVVLGVEKKSVA 53
            ||..|..:.|.:|     ..|..:|:|:|             |:|.||......::|.|:.::.:
  Fly    34 SSNMDNPLAIMAP-----PYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATS 93

  Fly    54 -QLQEDRKVRKICMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLK 117
             :|...:.:.|:..::.:::...||..||..........||:.|.|..::.:.::...::|:.:.
  Fly    94 GKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVA 158

  Fly   118 QKYTQSNGRRPFGI--SCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYRE 180
            .:|      :..|:  ..::.|:..:|.: |...:.:|:....|..|.|..|.......:..||.
  Fly   159 AEY------KGMGLCMGMMLAGWSPEGPS-LVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRL 216

  Fly   181 EEVANEHGAVKLAIRAL 197
            :...||  |..||..|:
  Fly   217 DLSDNE--AYDLAFLAV 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 42/209 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 42/209 (20%)
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 40/200 (20%)
proteasome_beta_type_5 72..259 CDD:239730 34/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440932
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.