DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma5

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:239 Identity:81/239 - (33%)
Similarity:136/239 - (56%) Gaps:10/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKVRKICML 67
            |.|||.|..|||:|.|.|||||.||::.||||:|::.:..|.|.|||:..:.|.|...:.||..:
  Rat     6 SEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEI 70

  Fly    68 DNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNG-----RR 127
            |.|:..|.:||.|||:.:|::|:||.|:|.....:.:|:|.:|:.::.|..::.:.:.     .|
  Rat    71 DAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSR 135

  Fly   128 PFGISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKL 192
            |||::.|.||.|..| ..||..:|||.|.:..|.|.|.:::..:...::.|.:.....|  |:|.
  Rat   136 PFGVALLFGGVDEKG-PQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKE--AIKS 197

  Fly   193 AIRALLEVAQSGQN--NLEVAIMENGKPLKMLDTDVITDYVKII 234
            ::..|.:|.:...|  |:|:|.::.|:...|...:.:.:.:|.|
  Rat   198 SLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 78/232 (34%)
proteasome_alpha_type_7 5..213 CDD:239724 76/214 (36%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 76/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.