DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha4 and Psma4

DIOPT Version :9

Sequence 1:NP_525092.1 Gene:Prosalpha4 / 32584 FlyBaseID:FBgn0004066 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:259 Identity:83/259 - (32%)
Similarity:147/259 - (56%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVVLGVEKKSVAQLQEDRKV-RKI 64
            ||.|||...|||||:|.|.|||||.||:....|.:|:...:.|:|..|::::.:|.::... .||
  Rat     1 MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKI 65

  Fly    65 CMLDNHVVMAFAGLTADARIMINRAQVECQSHRLNVEDPVTLEYITRFIAQLKQKYTQSNGRRPF 129
            ..|:..:..:.||:|:||.::.|..::..|.:.|..::|:..|.:...:..:||.|||..|:|||
  Rat    66 YKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPF 130

  Fly   130 GISCLIGGFDADGSAHLFQTEPSGIFYEYKANATGRSAKVVREFFEKSYREEEVANEHGAVKLAI 194
            |:|.|..|:|......|:|::|||.:..:||...|.::.......::.|:|.|:..: .|:.||:
  Rat   131 GVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLK-SALALAV 194

  Fly   195 RAL---LEVAQSGQNNLEVAIM--ENGKP----LKMLDTDVITDYVKIIEKEKEEELEKKKQKK 249
            :.|   ::|::.....:|:|.:  ||||.    ||..:.:      ::|:|.:|||.:.:::||
  Rat   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVE------QLIKKHEEEEAKAEREKK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha4NP_525092.1 PRK03996 5..231 CDD:235192 73/235 (31%)
proteasome_alpha_type_7 5..213 CDD:239724 67/211 (32%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 68/213 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.